PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 587aa    MW: 64853.8 Da    PI: 8.1036
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009102genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.6e-4371061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++lp  +reda++sl+yeA+ar+rdP+yG+vg+i+ lq++l+q++ el  +k
  DCAR_009102   7 PCAACKLLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNDLPAVQREDAVNSLAYEADARLRDPIYGCVGLISILQHKLKQVQMELYNAK 104
                  7*********************************************************************************************9988 PP

       DUF260  99 ee 100
                  +e
  DCAR_009102 105 KE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9366107IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-427104IPR004883Lateral organ boundaries, LOB
SuperFamilySSF1034731.96E-20239315IPR020846Major facilitator superfamily domain
Gene3DG3DSA:1.20.1250.201.0E-4240311No hitNo description
SuperFamilySSF1034731.96E-20363574IPR020846Major facilitator superfamily domain
Gene3DG3DSA:1.20.1250.202.1E-5377544No hitNo description
CDDcd061740.00101421541IPR020846Major facilitator superfamily domain
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MSSSNSPCAA CKLLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNDLPAVQR  60
EDAVNSLAYE ADARLRDPIY GCVGLISILQ HKLKQVQMEL YNAKKELSTY IGPSAMLPIL  120
PAPGNFIPPY QHQQPSQMMP YNMQAAQMMG GSPQNVVNPN PLVIQQQQNY QQIMEAQQVA  180
AVVAAAREQE MLRSYEQQQA VLTQQQGRHS DQLTTSVVCK PSVQRKKEKE GEIFTSERIS  240
TSWGVGLVIG PAIGGYFAQP AENYPNIFSE KSIFGRFPYF LPCLLISLFA FLVSIISFWL  300
PETLHIHHGN KNEQCDAADA LENSMYKYRV DGVSRHGNKN EQCDAADASE NSMYKSRVDG  360
VIRSKERLPS SKLSLLRNWP LMSAITVYCV FQLHDTAYAE AFTLWADSPR KYGGLHYKIP  420
EVGEVLAISG FGLLILQMFL YPVLERTFGA ILVSRIGAVA TIPLLTCYPY IAKLSGNLLF  480
AVLSCASILM NVLMVSVSTG LYLLQNRAVS SDQRGAANGI SMSALSLFKA FGPACGGSFF  540
SWAQTRQNPT FLPGDQIVFS ILNSIEFIGL AMTFKPFLVL PNDDSQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007028171.11e-136Zinc induced facilitator-like 1 isoform 3
RefseqXP_015888436.11e-135PREDICTED: protein ZINC INDUCED FACILITATOR 1-like
SwissprotQ94BZ11e-114ZIFL1_ARATH; Protein ZINC INDUCED FACILITATOR-LIKE 1
TrEMBLA0A061EVN01e-136A0A061EVN0_THECC; Zinc induced facilitator-like 1 isoform 3
STRINGPOPTR_0016s02500.11e-128(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-68ASYMMETRIC LEAVES 2-like 1